TB500 (5MG) – Research Peptide
Certificate of Analysis (COA) Tested ✅
TB500 is a synthetic peptide supplied exclusively for scientific and laboratory research applications. It is intended for use in controlled research environments where accuracy, traceability, and analytical consistency are required.
This peptide is provided in a form suitable for in-vitro and non-clinical experimental work, supporting researchers conducting peptide structure analysis and related biochemical investigations.
Product Specifications
Product Name: TB500 5 mg
Catalogue Number: PEP-TB500-5MG
Molecular Formula: C₂₁₂H₃₅₀N₅₆O₇₈S
Molecular Weight: 4963.4 g/mol
Purity: 99% (Verified by HPLC)
Amino Acid Sequence:SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Form: Lyophilised solid
Handling, Storage, and Preparation
TB500 is supplied as a lyophilised solid to support stability during storage and handling in laboratory environments. Researchers should consult Peptiva’s website for general guidance on appropriate storage conditions and handling procedures for peptide materials used in research.
All preparation, dilution, and storage should be performed using standard laboratory protocols and in accordance with institutional guidelines.
Synthesis and Quality Control
TB500 is synthesised using a controlled peptide production process designed to achieve consistent chemical purity and batch reproducibility. Each production lot undergoes analytical verification to confirm identity, purity, and compliance with defined specifications prior to release.
Peptiva places strong emphasis on batch traceability, documentation, and quality assurance, supporting reproducible research outcomes across professional laboratory settings.
Why Choose Peptiva
Peptiva supplies peptide materials exclusively for research and development purposes within the UK. We focus on providing clearly documented, high-purity peptides intended for laboratory use only.
By working directly with established manufacturing partners and maintaining strict quality oversight, we aim to deliver reliable research materials suitable for professional scientific environments.
Legal and Safety Notice
This product is supplied strictly for research use only.It is not intended for human or veterinary use, diagnostic procedures, or clinical applications.
Peptiva does not market this product for consumption, therapeutic use, or administration to humans or animals. By purchasing this product, the buyer confirms that it will be handled solely within a professional research or laboratory setting and in compliance with all applicable UK regulations.
TB-500 (5MG)
Please contact us to view Certificate of Analysis (COA) for this product!









